SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000573054|PACid:22624774 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000573054|PACid:22624774
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000135
Family B3 DNA binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000573054|PACid:22624774
Sequence length 272
Sequence
MIVLEDAKGKEFGRKYLVEKGGLSGGWRGFSIAHKIMKGDVVIFHLVTPFKFEVYIVRSN
EVDWSLPLMRVDPPIRQMDIGVMCGKWHRNHKQLLSFLILACDLNHAGGFTACGKEEREN
LEPIPQENAIVCYTDSGPTSDQSENDGEDVGSEFLDGLRLSESVVTFKEVHCLDNFHVQN
SFLHEQLVEGLNCKLTAGVIFETVNIADAIRACKITTPEGYLSTWDKTLKAFDDLGMNVC
VPACPPGPAYKRGAASLPRSTTKEISCLNTMD
Download sequence
Identical sequences MDP0000573054 MDP0000573054|PACid:22624774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]