SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000593607|PACid:22667484 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000593607|PACid:22667484
Domain Number 1 Region: 19-177
Classification Level Classification E-value
Superfamily L domain-like 7.37e-32
Family Polygalacturonase inhibiting protein PGIP 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000593607|PACid:22667484
Sequence length 209
Sequence
MANCLTAGVLAISHTNISTDQSALLSLKAHITSDPQNILTANWSSASNSNICNWVGVSCG
AGHHRVTXLNLSHMGLAGVIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKEINFG
NNSFMGTIPSWFGSFAKLQTIKLYGNGFSGFIPATIFNLSALETIDLGRNQLSGTYIPPV
PTTYLHPHLLVGKLMSCTAMNLTGGVGIY
Download sequence
Identical sequences MDP0000593607 MDP0000593607|PACid:22667484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]