SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000596090|PACid:22632224 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000596090|PACid:22632224
Domain Number 1 Region: 87-136
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000493
Family Retroviral integrase, catalytic domain 0.044
Further Details:      
 
Weak hits

Sequence:  MDP0000596090|PACid:22632224
Domain Number - Region: 142-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00141
Family N-terminal domain of adrenodoxin reductase-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000596090|PACid:22632224
Sequence length 229
Sequence
MQGPKCTSITYPYFGWLDDLMRHLEHDPWILQKSKEVMEGPTSGVIDKSLSKYHLDNGFL
KYNSRMVIPPDLSWRKRLFEKHHFTPITGHEGDATTIVSDRDYVFLSMFWNEFFKLQGSR
LCMSSEYHPQRDGQSEVGLVVDLTVVDGGPVGLIVAQQVSEAGFSIYSIDPSPKLIWPNS
YGVWVDEFETMDLLDCLDTTWSGAVVYIGEELNKDLNRPYGRVNRKQLK
Download sequence
Identical sequences MDP0000596090|PACid:22632224 MDP0000742489|PACid:22661380 MDP0000596090 MDP0000742489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]