SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000638870|PACid:22646063 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000638870|PACid:22646063
Domain Number 1 Region: 65-180
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000158
Family Thi4-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000638870|PACid:22646063
Sequence length 182
Sequence
MDYQYVLGGVLVSLLGSVFFMIINTTLSGEKKKVVEKDSRGINGDGYVRMPSQNGSFHPE
IASGTDVVIVGAGVAGAALAYTLGKEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELG
LEDCANESXDAQKVFGYALYKNXNDTKLSYPLENYTXDIAGRSFHNGRFIQKMRERVATL
KK
Download sequence
Identical sequences MDP0000638870|PACid:22646063 MDP0000638870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]