SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000738522|PACid:22680891 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000738522|PACid:22680891
Domain Number 1 Region: 44-199
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000722
Family FAD-linked reductases, N-terminal domain 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000738522|PACid:22680891
Sequence length 206
Sequence
MSAISSVLLLLVLYLQSEVHSLATPSDHGESLPTSYPNVLTQDGFAYNLQQEDDGTTPVQ
RIMSEDGIPTVRGRLLGGTSMINAGVYARANMSFYNQSGIEWDMELVNNTYEWVEDTIVY
KPNSFPWQSVIREAFLEAGGYDPDNGFSLDHIKGTRVTGSTFDNYGTRHGADELLNKGNP
NNLRVAVHATVEKIIFSSNESGMLHL
Download sequence
Identical sequences MDP0000738522|PACid:22680891 MDP0000738522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]