SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000745172|PACid:22667211 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000745172|PACid:22667211
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-17
Family Tyrosine-dependent oxidoreductases 0.0033
Further Details:      
 
Domain Number 2 Region: 232-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000547
Family Thi4-like 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000745172|PACid:22667211
Sequence length 352
Sequence
MCKEGRLTLRFEDVTTGQRFRAKGHNDFYSATKAQGEELVIKANGVKGLLTCCIRPSSIF
GPGDRLLVPSLIVNARTWKSKFIIGDGNNIYDFTYVENVAHAHICAERALASEGKVADKA
AGQEGLKRTIEAYPHLRAEHRPKREGPSKASIYLGSGRGYKIEKLQSSHFRLSEETSQQI
AKSLASSWNASVKTLISLAKGYDGILFLKPAKAAPASNGGLSVSTSANGLNSSYDLSAFK
FDPIKESIVSREMTRHYMTDMITYADTGIVLVGAGSAGLSCAYELSKNPDVQVAITEQSV
SLGGGAWLSGHLLSAMDSDPKPHTTSRRPARKSGQSTQNPKALIIFRKRRKQ
Download sequence
Identical sequences MDP0000745172 MDP0000745172|PACid:22667211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]