SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000746652|PACid:22636428 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000746652|PACid:22636428
Domain Number 1 Region: 65-218,312-423
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-37
Family Thi4-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000746652|PACid:22636428
Sequence length 511
Sequence
MDYQYVLCGVLVSLLGSVFFMIINTTLSGEKKKVVEKVSNGVNGNGYVWMPSQNGSFVPD
IARGTDVVIVGAGVAGAALAYTLGKEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELG
LEDCANESIDAQKVFGYALYKNGNATKLSYPLENYTSDIAGRSFHNGRFIQRMRERKKGT
IKGVMYKNKAGEEMRSYAPLTIVCDGCFSNLRRNLCTPNVENPSCFVGLILENCDLPHAN
HGHVILGDPSPILFYPISGTEVRCLVDVPGTKVPSVANGEMAKYLKNVVAPQVPPQLLKA
FLAAVEKGNIRTMQNKSMAAHPQPTPGAILLGDAFNMRHPLTGGGMTVALSDIVLLRDLL
RPLTDLNDAPALCEYLESFYTLRKPVSSTINTLAGALYKVFCASPDPARQEMREACFDYL
SLGGLCTRGPISLLSGLNPRPIHLFLHFFAVAVYGVGRLMIPFPTPKRVWLATRLLLGAS
GIIFPIIKGEGVRQMFFPATIPAYYRAPPLE
Download sequence
Identical sequences MDP0000746652 MDP0000746652|PACid:22636428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]