SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000748068|PACid:22649054 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000748068|PACid:22649054
Domain Number 1 Region: 29-217
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.03e-29
Family GMC oxidoreductases 0.0009
Further Details:      
 
Domain Number 2 Region: 1-26,216-271
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000165
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000748068|PACid:22649054
Sequence length 278
Sequence
MLSGVGPAEQLKAHNITVVVDQPMVGQGMSDNPMNAIFVPSPIPVEVSLIQVVGITHFGS
YIEAASGENFAGGSTTKDFGMFSPKIGQLSTVPPKQRTPEALAEAVRYMDSLEDAAFKGG
HMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIETIEKIIESKAFSKFRYEGMSIAALLN
ATASSPVNLLPKHANASRSLDQFCKDTVMTIWHYHGGCQVGRVVDHDYKVLGVDALRVID
GSTFNYSPGTNPQATVMMLGRYMGKTILDERLASDVSN
Download sequence
Identical sequences MDP0000748068 MDP0000748068|PACid:22649054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]