SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000750392|PACid:22633787 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000750392|PACid:22633787
Domain Number 1 Region: 252-362
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-28
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000750392|PACid:22633787
Sequence length 841
Sequence
MREGHTPNXKKXDRRHAWRQPDVTPLGLKGWQSPTSLVLGLPPSLGLPNVGAKPTDPRAL
SSGLSPEQGPTVDSYMRIFDADDSPSSFPSEAFSSVNFXAAGEELRALDFRRTWKVVPRP
SPQIFNFSPTAELLRARGIGISRRKLKEGDRCLDPQLWHACAGGMVQMPPVNAKVFYFPQ
GHAEHACGPVDFRNCPRVSPYILCRVAAIRFMADPETDEVYAKIRLVPLNGVEAGYEDDG
IGGLNGSETPDKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSANPPVQTILAKD
VHGETWKFKHIYRGTPRRHLLTTGWSTFVNHKKLVSGDSIVFLRAENGDLCVGIRRAKRG
SGSGPESSSGWNPMGGNCTVPYGGFSAFLREDENNLMRNGNGNISNSNGSLVGKGKVGPE
SVSEAATLAANGQPFEVVYYPRASTPEFCVKASLVKAALQIRWCPGMRFKMAFETEDSSR
ISWFMGTISSVQVAEPLRWPESPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPAIHLT
PFSLPRKKMRLPQYPDFPFEGQLPMPTFSGNLLGPSSPFGCLPDKTPAGMQGARHAHYGL
SLSDMHLNKLHTDLFPAGFPPLXHAAAPTKFTNNMVIHKPTISENVSCLLTMSHFTPTSK
KPDDVKPPQLILFGQPILTEQQISLSSSGDTVSPVLTGNSLSDGNADRMVNHSDNSGSAL
HRQSIQERSSCEGFQWYKDTRNETELSLETGHCKVFMESEDVGRTLDLSLLGSYDELYRK
LADMFDIDNSETLNHVLYRDGTGAVKHIGEEPFRYGQFPLNRVMAPKDRGPCPFNYQMSG
W
Download sequence
Identical sequences MDP0000750392|PACid:22633787 MDP0000750392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]