SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000751628|PACid:22634476 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000751628|PACid:22634476
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.73e-38
Family RecA protein-like (ATPase-domain) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000751628|PACid:22634476
Sequence length 181
Sequence
MGGIGKTTLAETVFHKLSSKFDASGFVKNVREKSEKADGLDHLEKTLLKEILKEEGLSMG
STFVRDRLKCTKVLIVLDDVSDSIQLERLAGKRLRYGTGSRIIITSRDKRTLPEEGKIYE
VEGLKRDDALQLFCSHAFKNKSTPITDYKELAEKAVDYAGGVPLALKLLGPLFFSCKSKA
D
Download sequence
Identical sequences MDP0000751628 XP_017180210.1.92800 MDP0000751628|PACid:22634476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]