SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000755938|PACid:22650525 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000755938|PACid:22650525
Domain Number 1 Region: 38-212
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000168
Family FAD/NAD-linked reductases, N-terminal and central domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000755938|PACid:22650525
Sequence length 216
Sequence
MPLEKYGLKPDHSFEEDYASCQMAIMPENFFSEADKGKIVFKRSTSKWWFSADGIEFDDN
TKIKADVVVLATGYDGKKKLKFILPDPFRSLLEYPSGIIPLYRGTIHPLIPNMAFVGYLE
SVSNLHSSELRSIWLARLLDNKFKLPSVQKMLEQTSKEVEISKKTTRFYRRHCISTFSIN
HSDEICEEMGWTSWRKNTWLAEAFSPYGSQDYLNKH
Download sequence
Identical sequences MDP0000755938|PACid:22650525 MDP0000755938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]