SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000760685|PACid:22640172 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000760685|PACid:22640172
Domain Number 1 Region: 5-149
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000319
Family Phosphoribulokinase/pantothenate kinase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000760685|PACid:22640172
Sequence length 223
Sequence
MCRYDQRVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAYID
PQKQYADAVIEVLPTQLIPGDNEGKVLRVRLIMKEGVKYFNPVYLFDEGSTISWIPCGRK
LTCSYPGIKFNYGPDTYFGNEVSVLEMDGQFDRLDELIYVESHLSNISTKFYGEVTQQML
KHSDFPGSNNGTGLFQTIVGLKIRDLYEQLIAARAKTPAEAKA
Download sequence
Identical sequences MDP0000760685|PACid:22640172 MDP0000760685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]