SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000795789|PACid:22682846 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000795789|PACid:22682846
Domain Number 1 Region: 139-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000687
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000795789|PACid:22682846
Sequence length 268
Sequence
MGFTEKDFDASQNRMIALLEVARLATEDLVQEELMKQKRKIKKPMLIDWAAKKNRSSNIS
FKRNWEMVDDPGDVGWTPVELKMQKMSLKNNNKKGADTMNIALKKKETISPSAPLGYHDL
PEKFKREIERLGGTKVELVIEKQLTKTDLRSGRMSMPLNQIVSISFLEDEDMEMLENGET
MTVRLIDPGLVQGDINLRRLEKREGKNPIYVLRTQWGDVARKNKLKAADLVQVWSFRVNR
ALHLALVLVKSSSVDGDRQEIMEEWKRW
Download sequence
Identical sequences MDP0000795789|PACid:22682846 MDP0000795789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]