SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000813172|PACid:22649115 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000813172|PACid:22649115
Domain Number 1 Region: 12-273,372-441
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.34e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000344
Further Details:      
 
Domain Number 2 Region: 464-605
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.44e-48
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 250-368
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.5e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000795
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000813172|PACid:22649115
Sequence length 605
Sequence
MHFWFFQATGRSPYTVVDHTYDAVVVGAGGAGLRAAIGLSEHGFNTACITKLFPTRSHTV
AAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIELENYGLPFS
RTEDGRIYQRAFGGQSLDFGKGGQAYRCACAADRTGHALLHTLYGQAMKHNTQFFVEYFA
LDLLMDSEGGCQGVIALNMEDGTLHRFQASSTILATGGYGRAYFSATSAHTCTGDGNAMV
ARAGLPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASR
DVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPDVLKERLPGISETAAIFAGVDVTKEPI
PVLPTVHYNMGGIPTNYHGEVVTIKGDDPDVTIPGLMAAGEAACASVHGANRLGANSLLD
IVVFGRACANRVAEIHKPGEKQKPLEKDAGEKTIAWLDKIRNSNGSLPTSKIRLNMQRIM
QNNAAVFRTQETLEEGVQLIDKAWESFHDVQLKDRSLIWNSDLIETIELENLLINASITM
HSAEARKESRGAHAREDFTTRDDEKWMKHTLGYWENKKVRLDYRPVHMNTLDDEIETFPP
KARVY
Download sequence
Identical sequences MDP0000813172 MDP0000813172|PACid:22649115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]