SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000814529|PACid:22673539 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000814529|PACid:22673539
Domain Number 1 Region: 62-125
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000129
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000814529|PACid:22673539
Sequence length 145
Sequence
MGPNRINSPCGHKIDAAPLLPCSLRTKPDEMERFAGKGIGFWDLWERAGRTKGGETKKKM
FTSVDCVVVGGGISGLCIAQVLATKHSDAIPIVIVTEAKDQVGGNIITVEKDSYAGQRHG
CVWRGRTRLNCPVVLERINKRVFTV
Download sequence
Identical sequences MDP0000814529 MDP0000814529|PACid:22673539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]