SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000819543|PACid:22662298 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000819543|PACid:22662298
Domain Number 1 Region: 100-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-21
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000819543|PACid:22662298
Sequence length 436
Sequence
MEEAMVILQDQKQSSSYPLLQLPPPPPLHKGMETEKQFGQKPPCFQPTTTSNVLNANANP
MMFKCPKRKAPVRVRVESLYDSSQAQSSVLERAKKIEASLDDKFPSLLKVMMPSEVSGGF
YLNLAKKFRSEYMPKQDSMIVLEDENGKEFGTKYLVEKGGLSGGWRGFSIAHKIKKGDVV
IFHLVTPSKFKVYIVRSNEVDWSIPLMRVDPPIRQMDTGGFTACGKEERENLEPNPQENA
IVCYTDSGPTSDQSGNDGEDVGSEFLDGLRLSESVVTFKEVHCLDNFNVQVNGLIINSEF
SKYVLTKYYELCCSQKSFLHEQLLEGLNCKLIAGVISETVNIADAIRACKITTPEDYLST
WDKTLKAFGDLGMNVRFLRARLDQLTSLASKSKRLEANVLEVKETMNSLDSEVETPNTSL
EEEREIPFQEMAKAPW
Download sequence
Identical sequences XP_008373165.1.92800 MDP0000819543 MDP0000819543|PACid:22662298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]