SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000866499|PACid:22626100 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000866499|PACid:22626100
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.14e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0016
Further Details:      
 
Domain Number 2 Region: 147-240
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.49e-25
Family Middle domain of MutM-like DNA repair proteins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000866499|PACid:22626100
Sequence length 272
Sequence
MPELPEVEAARRAIEEHCVGKKITKALIADDSKVIDGVSRADFEASLLGKTIVSAHRKGK
NMWLCLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVKDTDEWPSKYSKFFVELDDGLEF
SFTDKRRFARVRLLKDPTSVPPISELGPDALLEPMTVNELFECFSKKKIAIKTLLLDQSV
ISGIGNWVADEVLYQARIHPEQSAASLSKENCAALHTSIKEVLEKSLEVGADSSQFPSDW
IFHSREKKPGKAFVDGLVPDPCVIICYRLTLD
Download sequence
Identical sequences MDP0000866499|PACid:22626100 MDP0000866499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]