SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000876321|PACid:22663258 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000876321|PACid:22663258
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-44
Family B3 DNA binding domain 0.0045
Further Details:      
 
Domain Number 2 Region: 1035-1100
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000137
Family PB1 domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000876321|PACid:22663258
Sequence length 1149
Sequence
MKVPTNGFMENSGEGEQKRINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
TDFIPNYPNLPSKLICMLHNVTLHADTETDEVYAQMTLQPVNKYEKEALLASDMGLKQSK
QPAEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELVAKDLHDSAWTFRH
IYRGQPKRHLLTTGWSIFVSTKRLFAGDSVLFIRDEKSQLLLGIRRANRQQPAICSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMF
ETEEAGVRRYMGTITGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVVTP
FYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDEFGMKNSPSSVFPGLSLMQWM
NMQQNNQFSASQSGFFPSMVPPTGLQNNLGTDDPSKLLNFQAPVLSAPGLQSNKSAPQNQ
ASQMQQPNVTWAQQQQLQQLMHNPMSQQQQSNPQQQQLHQLLNSSANQHQQNHPQQQLQQ
LLQTPTNQQLQNYSHQQQREPQQQQDPQNLLQHQQLHQQQPQRQQHQQQQLSQPNPVNNG
SVAPNQVPGQNLQQPVMFSQHQQQQLLTGNTQSQQAVHSSSKNSFQVPTGQQNSQLQQQQ
LEPQPGVLQRQQQVSQLQPSPQQFLQQNMSQKVQQQPQVQQSSQQGISEQQLQLQLLQKF
QQQQQPQLLSPSSSLLQPQLLQQQLAHQQNQQLQQLPMTQHHQQQLSGNSFSTDRLLNNF
AAPSVMQSHHMPSIQPQNQHKPLTAIRSHSGLTEGDGPSCSTSPSTNNCQMSPSKYSNRN
QQGTAMLLGDSVAEPAHNLVQELQSKSDIRIKNELPSSKGPDQIKYKGTITDQLEASSSG
TSYCLDASTIHQNYALPTFCLDGDVQSNPRSSLPFSANIDGLAPDTLLSRGYDSQKDLQN
LLSNYGGTPRDIEIELSTAAISSQSFGAPNLPFKTGCSSDIPITDTGVLGNGLWANQAQR
MRTYTKVQKRGSVGRCIDVTRYKGYDELRHDLARMFGIEGQLEDPHRTDWKLVYVDHEND
ILLVGDDPWEEFVSCVQSIKILSSVEVRQMSLDGDLGNIPVPNQASSGTDSGNAWRPQYD
DNSAASFNR
Download sequence
Identical sequences XP_008337825.1.92800 MDP0000876321 MDP0000876321|PACid:22663258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]