SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000876898|PACid:22679933 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000876898|PACid:22679933
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.66e-18
Family G proteins 0.000012
Further Details:      
 
Domain Number 2 Region: 118-216
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000622
Family FAD-linked reductases, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000876898|PACid:22679933
Sequence length 299
Sequence
MFDVTARLTYKNVSTWHRDLCRVCENIPIVLCGNKVDVKNRKVKAKQVTFHRKKNLQYYE
ISAKSNYNFEKPFLYLARKLAGDPNLHFVESLALAPPEVPHQLLKPFLAAVVKGIIRTMQ
NKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDIVLLRDLLRPVTNFNDAPALCE
YLESFYTLRKPVSSTINTLAGALYKVFCASPDPARQEMGEACFDYLSLGGVCSNGPIFLL
SGLHPRPISLFLHFFVVAVYGVGRLMIPFPTPKPLWLGARLILVCLLNVQYFLISKLFT
Download sequence
Identical sequences MDP0000876898 MDP0000876898|PACid:22679933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]