SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000886637|PACid:22641953 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000886637|PACid:22641953
Domain Number 1 Region: 115-254
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-43
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 1039-1115
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000133
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000886637|PACid:22641953
Sequence length 1149
Sequence
MQILDDLLIFRYPGEQKRINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKET
DLIPNYTNLPSKLICMLHNVTLHADTETDEVYAQMTLQPVNKYEKEALLASDMGLKQSRQ
PAEFFCKTLTASDTSTHGGFSVPRRAAEKILPPLDFSMQPPAQELVAKDLHDSAWTFRHI
YRGQPKRHLLTTGWSVFVSNKRLFAGDSVLFIRDEKSQLLLGIRRAHRQQPALSSSVISS
DSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVVPLAKYNKAMYTQVSLGMRFRMMFE
TEESGVRRYMGTVTGISDLDPVRWKGSQWRNLQVGWDESTAGDRPSRVSIWEIEPVITPF
YICPPPFFRPKFPKQPGMPDDESDIDNAFRRAMPWLGDEFGMKNSPSSFFPGLSLVQWMN
MQQNNQFSAAQSGFFPSMVPPTGLQNNLGTDDPSKLLSFQAPVLSSLGLQSNKSAPQNHA
SQMQQPNVTWAQQQQLQQLMHNPMNQQQQSNPQQQQLQQLLNSSVNQHQQNHPPQQQLQQ
LLNSSANQHQQNHPQQQQQLLQTPTNQQLHNFSHQQQQREPQQQQEXQNLLQHQQLHQQQ
PQRHQQQQLSQPNPVNNGSVAPNQVPGQNSQQPVMFSQHQQQQLLTGNTQQAVPSSSKNS
FQLPTGQQNSQLQQQQLEPQPSLLQRQQQAAQLQSPPHQLLQQSVSQKVQQQPQVQQSSP
QGISEQQLQLQLLQKFQQQQQPQLLSSSSSLLQPQLLQQQLARQQNQQLQQLPMTQHHQQ
QLSGNXFSTDKLLNNFAAPSMMQSQHMPSIQPQNQHKPLTAIRSHSGLTEGDGPSCSTSP
STNCQMSPSNFLNRNQQGMAMLLGDSVAEPAHNLVQELQSKSDVWVKHEPPSSKGPDHIK
YKGTITDQLEASSSGTSYCLDTSTIHQNYALPTFCLDGDVQSNPRSSLPFSANIDGLAPD
TLLSREYDSQKDLQNLLSNYGGTPRDIETELSTAAISSQSFGAPNIPFKAGCSSDIPITD
AGVLGNGSWANQAQRMRTYTKVQKRGSVGRCIDVNRYKGYDELRXALARMFGIEGQLEEP
HRTDWKLVYVDHENEILLVGDDPWEEFVSCVQSIKILSSVEVQQMSLDGDLGNIPVPNQA
SSGTASGNA
Download sequence
Identical sequences MDP0000886637|PACid:22641953 MDP0000886637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]