SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000902209|PACid:22678199 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000902209|PACid:22678199
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.44e-18
Family Thi4-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000902209|PACid:22678199
Sequence length 293
Sequence
MASSSSCSVGSPSSLTQLHRPPPSLSPSCVRYAVLGAGFAGLSVAWHLLKQSPKDSNIRV
DIYDEAGIGGGASGVSGGLLHPYSPKAKLLWRAADCWSESLNLLSAAEAAVASAAQTSDG
PTPIVRRRGILRPALSLKNLVLLKDNAQSCLASCRIETLDNDAAQNLVPGISPPLDASFY
MPEAVNIHPQRYLQALFLACQNLVKELRASGTGVKELHLHKSSVHKLVDLEDSMFQIGCL
TFHAASVISEGEYQAVIVCLGAKADMLPELCGRLPLRTCRGVVAHLQLPDDIG
Download sequence
Identical sequences MDP0000902209|PACid:22678199 MDP0000902209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]