SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000911003|PACid:22677366 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000911003|PACid:22677366
Domain Number 1 Region: 114-279,387-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000191
Family FAD-linked reductases, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000911003|PACid:22677366
Sequence length 588
Sequence
MALLQLQSVNGLFHSTKEGPLLAQRRSARARRCLCLQTQAPPSRTQRIMESISVSGEVGG
AGGSYSYSALKRLDQVWSTICSARTVVEEPKKVVSSIPGLFSNSDLANKAVDTFDVLICG
GTLGIFIATALCAKGLRVGIVERNVLKGREQEWNISRKELMELVEIGVLLEGDIEQVTAA
KFNPNRCGFEGKGDIWVEDILNLGVSPAKLIEVVKNRFTSLGGVMFEGYSVSGVSIYEDA
AVLQLNEEKILSSRLIIDAMGNFSPIVKQIRSGRKPDGVCVVVGSCARGFTNNSTSDVIY
SSSLARKVGSSEAQLFWEAFPAGSGPTDRTTYMFTYLAPQPQSPKIEELLEEYWKLMPEY
QEVSLDDLEIQRVLYGIFPTYRDSPLPAAFNRVLQVFGDASGIQSPVSFGGFGSLTRHLN
RLSNGIYEAMSDNLLDSYNLSLLNPYMPNLSSSWLFQRAMSAKKESNVPPDFINELLYTN
FQSMQRLGDPVLRPFLQDVVQFGPLAKTLGLVMLTKPQIIPSIFKQVGIPVLLDWSGHFF
MLGYYTFLSTFADPVVRSFLSTLPTQAKYEWKRRLEAWKYGAGLDYKS
Download sequence
Identical sequences MDP0000911003 MDP0000911003|PACid:22677366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]