SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000912733|PACid:22637933 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000912733|PACid:22637933
Domain Number 1 Region: 15-54
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000379
Family B3 DNA binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000912733|PACid:22637933
Sequence length 176
Sequence
MSTTRYGSSGTFTEPRRHLLTAGWSTFVNRNKLVAGDSIVFLRAENGDLCVGIRKGKRGL
DGGGGNEVASRWNNSHSSGDGSGXCVLPYDRLCVFLREEDNKMRNGGGGLSPNGNMRGNG
RVRPESVVEAVTMAANGQPFEMVYYLRASMPVLLGENPDSKTIPGLDSGDLERWGL
Download sequence
Identical sequences MDP0000215770|PACid:22651835 MDP0000912733|PACid:22637933 MDP0000215770 MDP0000912733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]