SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000929655|PACid:22661337 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000929655|PACid:22661337
Domain Number 1 Region: 58-198
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-43
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 498-564
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000338
Family PB1 domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000929655|PACid:22661337
Sequence length 564
Sequence
MHQGSEQQMPSFNLPSKILCKVVNVQLRAEPETDEVYAQVTLLPEADQSEVTSPDPPLPE
TPQCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMTQQPPWQELVASDLHGNEWH
FRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENGELRVGVRRLMRQPSNMPSS
VISSHSMHLGVLATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYIEARSQKLSVGMRFK
MRFEGEEVPERRFSGTIVGVGDNTAPGWANSEWRSLKVQWDEPSSILRPDRVSPWDLEPL
VATTPQNSQPALRNKRARPPVLPSPSPDLSALGEWKSKAESPXAFSYSDSQRGRDIYPSP
KYNSASKPNSLCFTGNNSLAAVSGNSMFWPNRVDGVTEPFSPVMNKDCGERRQSTGNGCR
LFGIQLLENSNLEETSPVVTVSGKLGDTLPVSSFDAESDQHSEPSNLNRSDLPSGSCDAE
KSCLRSPQESQSRQIRSCTKVHMQGIAVGRAVDLTRFERYEDLLKKLEEMFDIEGELCGS
TKKWQVVYTDDEDDMMMVGDDPWQ
Download sequence
Identical sequences MDP0000929655|PACid:22661337 MDP0000929655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]