SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000945267|PACid:22621253 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000945267|PACid:22621253
Domain Number 1 Region: 159-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.37e-29
Family B3 DNA binding domain 0.0000185
Further Details:      
 
Domain Number 2 Region: 30-86
Classification Level Classification E-value
Superfamily DNA-binding domain 8.5e-16
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000945267|PACid:22621253
Sequence length 321
Sequence
MHVMDCLNESTSDSSNNGVKDASSNKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFN
EEEEAAKTYDIALLKFRGLAAITNFCQSQIKPYIEDGNEAIFLESHSKAEIVDMLRKHSY
VNELEMYKHKLLNAGVRGGGRKRSKCHVDPTDACYERELLFEKVATPSDVGRLNRMVIPK
QQAEKHFQVHESVELCKGVLLNFEDEEGNVWRFRYCYWSSSQSYVLTKGWTRFVKEKKLK
AGDVLRFQRSVREDKKLFIECRPRNVDSLRFREIPAGRVAEPLAAVQDDGVVRLFGVNIM
KTCNSCIVDNSRCWRLGASLR
Download sequence
Identical sequences MDP0000945267 MDP0000945267|PACid:22621253 XP_008341862.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]