SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000123346|PACid:22637294 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123346|PACid:22637294
Domain Number 1 Region: 52-131
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.04e-16
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000123346|PACid:22637294
Sequence length 151
Sequence
MATGLIRKAIASAAASESTAMASFRYIYVRAMASEAQAQQVDLKSRDKMDIKTFSIYRWN
LDNPKKLELKEYEINLKECGPIVLDALTKIKNEMDPTLTFRRSCREGIYGSCTMNINGCN
GLTKTQFMDFFXCWSHAVYFWRTQNCHHFLT
Download sequence
Identical sequences MDP0000123346|PACid:22637294 MDP0000123346 XP_008380659.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]