SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000123407|PACid:22657458 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000123407|PACid:22657458
Domain Number 1 Region: 227-327
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 2 Region: 8-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-23
Family B3 DNA binding domain 0.00087
Further Details:      
 
Domain Number 3 Region: 464-565
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-22
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000123407|PACid:22657458
Sequence length 583
Sequence
MAKEARNVRSPHFFAFYSADLSSERLKIPXRFMRHMEGRTSGLVLLFGPSGSAWSVELIQ
QNGGLFLHHGWPAFVRDHYVECGDFLVFRYDSDLCFTVLIFDQSACEKEAAFRFGYGQDS
SNFEKCMXVGRKRGMEEAASSGNKPVDGAXKKMRHGLSQLQSECIDEGQEEATCSKETNP
HENPGLDVVPNAAKASIQNVCGKGDGLNVNGRVCMQMSSAHEVAPVFSSSNPYFVRIIKS
FNISGSYTLNIPYKFSVAHLPNCKVKIVLQNWKGESWTVNSVPSTRVHTSHTLCGGWMAF
VRCNDIQLGDICIFELVRECEFRVHIQKGETSSWLSPGLAVTTHKTIKGLSKKIKGNSPK
VHSKSIREIADKLSSKMYQDAAFINDTRKYGSSSRSLTKVALSQSKVASKKLGHLHFSNL
NWFLNHKMETVNXRKKVVEDELDSQKRGLRIKLTLDEERVARSFTSCFPNFVKIMKKFNI
SGSYTLKVPYQFSTQYLPNYKTEILLRNSKGGCWTVNSIPDSKGRVVHTFCGGWMAFVRG
NDINFGDVCIFELVGKDEMQVHISGVGKKGFDHLGGQATSDVV
Download sequence
Identical sequences MDP0000123407|PACid:22657458 MDP0000123407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]