SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000134320|PACid:22653042 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000134320|PACid:22653042
Domain Number 1 Region: 144-222,302-532
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.58e-80
Family IF2B-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000134320|PACid:22653042
Sequence length 543
Sequence
MVGLSRIMPITTQQGPTVAQICPHHPIHSSLSGVPLSRLPLPLSFCVFSLHSPPFYFPPP
SPIPQTHLLLGLIFFEPIPLFFSASHSXSITRPLTHSRLNLVIAMPDVHSLVNDFLIKLK
KRLVVLRRTLIDYTGTSCVLKRLYCKIEGSLATAKQTAELIRSVISAQRVPYTNQAGALI
DAVKAVGEQLIAANPVELAVGNIVXRVLHIIREEDLSLTTAAXAGLNMSTVSDDEDDDRD
NHPVLSAAVVAAAARSTLRPPSLQMLLEDIPDAAAVPRTSSSGGDSEEKTKSADKSSRSR
RLKHDVIEAVNELIQDIGTCHEQIAEQAVEHIHHNEVILTLGSSRTVLEFLCAAKXKKRS
FRVFVAEGAPRYQGHLLARELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVI
APVGLNMVALAAQRHAVPFVVLAGSHKLCPLYPHNPEVLFNELRSPSELLDFGEFSDCMD
FGSGTASSLLQVVNPTFDYVPPKLVSLFITDTGGHNPSYVYRLIADYYSADDLVVQRRPA
XGS
Download sequence
Identical sequences MDP0000134320 MDP0000134320|PACid:22653042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]