SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000143020|PACid:22655471 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000143020|PACid:22655471
Domain Number 1 Region: 639-884
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000024
Family Tropomyosin 0.00078
Further Details:      
 
Domain Number 2 Region: 404-657
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000719
Family Tropomyosin 0.0017
Further Details:      
 
Weak hits

Sequence:  MDP0000143020|PACid:22655471
Domain Number - Region: 898-1159
Classification Level Classification E-value
Superfamily Tropomyosin 0.00048
Family Tropomyosin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000143020|PACid:22655471
Sequence length 1753
Sequence
MEEAQVISENPGEGCRECRDCKCRSDQGNRDLRSVIQAFLFASFVSNGELLPVEKEGKKE
EEEATFDGEFIKVERESIDVKDGSHAAETALAEDDKVSVIERSSSNLSRELLEAREKVSD
LEVEIERLAGALKHSESESSELKHEVLLTKKKLGESGKKYEELELSHKKLQEQITEAEEK
YSSQLNVLQEALQAQEEKHKDLIGVKESFDGLNLELESSRKRMQELEQELQSSACEVQKF
EELHKQSGSHAESETKRALEFEKLLEATRLSAKEMEDQMASIQGELKGLYEKIAEDEKVK
EALSSTAAELSAVQEELALSKSQGVNLEEKLSAKEALINELSEELSLKKASESQVKEDIS
ALENLFSSTKEDLQAKVSELEEIKLKLRDELSAKELVEAARKTHEEQSVAAQENLAIVTK
EKGGLEAAVADLTGNVQLMKELCSDLEGKLKLSEENFRQKDALLSQSLSNNAELEQKLKS
LEELHNESGTAFATVTDKNLELEAIIQASNAAAEEAKSQLRELEMLFIAVEQKNVELEQQ
VSAVELNRGITESGLEELSQKLSALNTALSKVEEEKKQLTGQVQEYQEKTGQLESALNQS
TLQYSDLQEELKTASEKCAEHEGRASEHHQRSLELEDLVQISHTKVEVTGKKVSELELML
ETEKSRIQELEEQITALEKKCQEAEADSGNYSNKVSELASELEAFQARTSSIEVELEAAN
EKGRELFEALNVATEEKKRLEDASSSFTEKFSESEKLVEVLREELKMTQEKLESIENDLN
TAGIREGEVIQKLKSAEEQLEQQGKVIKETMSKKSELEALHETLVRDSEIKLQEKIGRFT
NRDAEANSLLEKLKILEDQVKIYEEHVAEAAGKSASLKEELDNSLAKLASSESTNEELRK
QILEAENKASKFFSENEMLVEKNVQLKCKIDELQESLNTALSETEATTRELVLHKSSVEE
LTDKHSRALDLHSASEACIVEAETKLQEAIERLSQRDLEANDLLEKLNALEGQIKLYEEQ
VRETSAVSETRNAELEESLSKLNNLESFVEELQTKSAHFEEESRKLAEANIKLTEDVSTY
ESKLSDLEAKYSTAVVEKDETVEQLQAAKRTIEDLTQQHSSEGQKLQSQISSVMDENSLL
NEVHQNTKKELQQVISNLEEQLKEQKAGEAALKSEVENLKAEVAEKPLLQNSLKELEEKL
VKTEAQLQKEVESIKAAAAEREAELTSKLDDHAHKVHDRDLLNEQVTKLQSELQLAHATV
SEKKEADSQKDLEREASLKHSLEELEAKNKEIALLDKQVKELEQKVQLADTKVTERGDGG
SVAGLEVKSRDIGSIISTPSKXKSKKKSEATPAQTSSSSDIHTHTAEASPMTSVKFIVGV
VGVAVVLVDYFVNCFAWWTLSTERLKALFLCFQAWFLRDAFENIRIYAFVDMKRGRSQLF
ELAEPIQITGGWPRSHIFPPTFPHSAVMPGKEYNRHEHRVFLGCQTDLFEVVDPRAKLVV
HELDERSPSKSTGCSSEPLHKSTVEELTDKHSRALELHSASEARIVEAETKLQEAIETFS
QRDLEANGFSGKHQTFLAREXALKSEVEKLKAEAAEKPLLQXSLKELQTKSANCEAERRK
LAEANIKLKEDVYTYKSKLSDLEAKYSTAVAEKDXSVEQLQAAKXTIEDLTQQHSSEGQK
LQSQIXSLMDENRLLNEVHQNTXKELQQVISNLEEQLKEQKQENCFKSELKSQSELLRNL
CCKSLKNANQSLI
Download sequence
Identical sequences MDP0000143020 MDP0000143020|PACid:22655471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]