SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000147787|PACid:22655243 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000147787|PACid:22655243
Domain Number 1 Region: 50-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.32e-17
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000147787|PACid:22655243
Sequence length 154
Sequence
MATGFIRRAIASAAASGSTAMASFRYICVRAMASEAQAQQVDLKSRNKMDIKTFSIYRWN
LDNPKKLELNEYEINLKECGPIVLDALTKIKNEMDPILTFQRSCREGIYGSCTMNIDGCN
GLACLTKTQFMDFFICWIHAVYFWRTQNCHHFST
Download sequence
Identical sequences MDP0000147787|PACid:22655243 MDP0000147787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]