SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000153306|PACid:22674160 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000153306|PACid:22674160
Domain Number 1 Region: 260-649
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.02e-97
Family Regulator of chromosome condensation RCC1 0.00084
Further Details:      
 
Domain Number 2 Region: 648-719
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 69-147
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000212
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000153306|PACid:22674160
Sequence length 1147
Sequence
MMNGAPVRDRRGWWRYGNFSHMEWQILLATGMPTVTSTRYVENVKEFRFGKQLSXYNYWA
HNXLKALIYEAIIALKKGAQLLKYGRKGKPKFCPFRLSTAVFQRYLXPEKDYLSFSLIYN
NGKRSLDLICKDKVEAEVWIXGLKALISSGSGGRSKIDGWSDGGLYLDDGRDLTSNSQSD
SSASGARDSGSPEISVSFKTNSPKSFXPENSPVSEKSHAASDQTKMQVKGSGSDAFRVSV
SSAPSTSSHGSAPDDCEALGDVYIWGEAICDSVVKIGADKNXNYLSPRSDVLVPRPLESN
LVLDVHHIACGVKHAALVTRQGEVFTWGEESGGRLGHGAGKDVSQPRLVESLAANSVDFV
ACGEFHTCAVTMAGELYTWGDGMHNAGLLGHGTDVSHWIPKRISGPLEELQVASVTCGPW
HTALVTSTGKLFTFGDGTFGVLGHGDRKNIPYPREVESLSGLRTISVACGVWHTAAVVEV
IATQSSASXSSGKLFTWGDGDKNRLGHGDKEARLKPTCVPALIDYNFQKIACGHSLTVGL
TTSGHVFTMGSTVYGQLGNPNSDGKLPCLVEDKLXGDCVEEIACGAYHVAVLTSRNEVYT
WGKGANGRLGHGDIEDRKTPTLVEALKDRHVKYIGCGQNYTAAICLHKWVSGAEQSQCSA
CRQAFGFTKKRHNCYNCGLVHCHSCSSRKATRAALAPNPGKPYRVCDACYVKLNKVLETG
GNNRRNAIPRLSGENKDRLDKADIRLYKSAVLSNMDLIKQLDTKAAKQGKKADTFSLVRS
AQAPSLLQLKDVVMSTAVDLRRTVPKPVLTPSGASSRSVSPFSRRPSPPRFATPVPTTSG
LSFSKSIADSLKKTNELLNQEVLKLRSQVESLRQRCDIQELELQNSSKKVQEAMALAXEE
SAKSKAAKEVIKSLTAQLKDLAERLPPGVYDTETIKKAFLPNGLEPNGINYPDANEEQHS
RSNSISSSYLISSLGIDSATTNGNHVPXXSPKDPLGTNETNVQQSRELLTSNKLPNSGGS
FQSVSSSVSETVDGKESGPFQDGENGARSKNSPSPANGNTVEAEWIEQYEPGVYITLVAL
RDGTRDLKRVRFSRRRFGEQQAEIWWSENREKVYEKYNVRGSDKSSVAGSAARRSDGALS
PASSQQA
Download sequence
Identical sequences MDP0000153306|PACid:22674160 MDP0000153306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]