SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000155343|PACid:22620954 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000155343|PACid:22620954
Domain Number 1 Region: 46-143
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.72e-26
Family 2Fe-2S ferredoxin-related 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000155343|PACid:22620954
Sequence length 150
Sequence
MATLHLTPSPSLTLPKQVRTTTNLSASFQLNLRPRHRSRRSYSCTVRSYKVVVEHEGQST
ELEVEPDETILEKALDSGLSVPHDCKLGVCMTCPAKLLTGTVDQSEGMLSDDVVEGGYTL
LCVSYPKSDCLIRTIPEDELLSLQLATAND
Download sequence
Identical sequences XP_008351237.1.92800 XP_008390893.1.92800 MDP0000155343 MDP0000632432 MDP0000155343|PACid:22620954 MDP0000632432|PACid:22643094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]