SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000161022|PACid:22675604 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000161022|PACid:22675604
Domain Number 1 Region: 142-238
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.41e-23
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 475-575
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-20
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 3 Region: 29-71
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000334
Family B3 DNA binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000161022|PACid:22675604
Sequence length 684
Sequence
MASLRPTFSSTIPHFFKVILDDTSRDTKLGWPEFSKFYSLDYAFWLVFGYEGNSRFHVFI
FDRSCTEVDYPIKLPEKEKTDYEDDESVEILDDFPTSRRRKXERYSSLPCPLPPKKKGKS
YXRMHPLTEKDKAIALQRAIAFKSEKPHFKVAMQPSYIFGNLILPAGFAKRHLMHQPXGN
AILRLPDGGTWCVKLKIYEKGKVRFQRGWLEFVRDNNLKTGDVCVFILIKGIELAFEVXF
YRGTEAXNCSLSPGGHAKGARAMDQGKWEIGTSSSHDPYAGKECSGGLNLETXYEDHDDK
SVEILDDLCPRKSRDKSLVMPKLEETDKHDDXSNDDISRDSDEVQDDPTIPEEEETDYED
DXSVEILDDXSPCPRKTREKSPLPCLHKKMRTCSSSKAAECNTNFPATKTQPXEIKKSFR
SXXSYCSKSEVKSKEXVGGLSSSQIFXKRTXDVLGREHSLTKSEXALALQRANAFKSEYP
SFXVAIXPXYIHSSYLGLPYEFVRTHLNKQRSSNVILQILDGSTWPVTFKYDXTPRFQNG
WSVFARENNLKVGDLCVFELVNHDELTFEVVFFRATEAKMCSSSAGHGGGAIDQVEIKRR
SICKVKSGEYTKLKISDQVTQTPSCLKASRVLEAANNFIPKNPFFRATLGPTSKTVHVPV
KVAMRFPLRKAQTTTLQVGEHSGX
Download sequence
Identical sequences MDP0000161022 MDP0000161022|PACid:22675604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]