SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000164104|PACid:22664985 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000164104|PACid:22664985
Domain Number 1 Region: 73-120
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000833
Family 2Fe-2S ferredoxin-related 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000164104|PACid:22664985
Sequence length 127
Sequence
MAYPSTRISVMDHAIPCNPCISLSIHLKPPPFRQISWPNTVTHHSNITKWRRNTTSELQT
PVAVTDRTGDCSPSVPTHKVTVHDRQRGVSHQFLVPEDQYILHTAESQDITLPFACRHGT
VRSIISX
Download sequence
Identical sequences MDP0000164104 MDP0000164104|PACid:22664985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]