SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000179336|PACid:22642763 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000179336|PACid:22642763
Domain Number 1 Region: 224-616
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.41e-97
Family Regulator of chromosome condensation RCC1 0.00068
Further Details:      
 
Domain Number 2 Region: 12-89
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-18
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 616-687
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.8e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000179336|PACid:22642763
Sequence length 1063
Sequence
MVQIDSLARKNYLDESVLIWYSGKEEKYLKLSQVSRIVPGQRTQTFQRYPRPEKEYQSFS
LICXDRSLDLICKDKDEAEVWFTGLKALISRGLHQKGRPESRSGITSEANSPRSHTQQSS
PLSSPFCSGDSSQKDGVEPFHLHAAFESPPKIGLEKALSDVMLYALPPKIPFPSDAACGS
VPSPGGSDGMNGRTKGAGVDAFRVSLSSAVSSSSQGSGHDEVDALGDVFIWGEGVGDCFL
GGGSHRVESSSSCKMDSFVPKVLESAVVLDVQSIACGGQHAAFVTKQGEVFSWGAELGGR
LGHGVDADVSHPKLIDALKNMNIEFLACGEYHSCAVTLSGDMYTWGGSTSNFALLGHGFQ
SSQWVPKKLNGPLEGIHVSSVSCGPWHTAVVTSAGQLFTFGDGTFGVLGHGDRKSISVPR
EVDSLKGLRTVRVACGVWHTAAVIEVMVGSSSSSNCSSGKLFTWGDGDKGRLGHGDKEAR
LVPTCVASLVEPNFCKVACGQSLTVALTTTGHVYTMGSPVFGQLGVPKADGKLPRRVEGK
LMKSFVEEIACGANHVAVLTSRTEVYTWGKGANGRLGLGDTEDKFSPTLVEALKDKQVKS
IVCGTNFTAAICLHKWLSVIDQSMCSGCRLPFNFKRKRHNCYNCGLVLCHSCSSKKCLKA
SMAPNPNKPYRVCDNCFAKLRKATETNSSSGSAISRRGSMNQGFNELIQNNFIEMESGSS
KRNKKMDFSSNCVIPIANGVSERRALNGTRSFNPVFGSSKKFFSASLPGSRIASRATSPT
LRRSSPPRSTTPTPALSGLTLPKVGDDAKRKNVSLSEEVLKLKAQVEDLTRKAQLREIEM
EKTGQQLKEALKVAGEETVKCKAAKEVIKSLTAQVGFILMFIVSMHSAFKQFRVCNNDCG
RFDFSSTSTNGEVNAFFVSKARRRVWCLKASXXKKXXISERLPIGTAFVSSSEKILMCHG
PLLITQKWHIQKQQLGIKTEEQKLKQHKGLNGLSKMNLVYILPXFXCLEVSKISSAFASV
EGGSARNKQSSGGRQIGVEYISSTMFGRFKNPSFPTRRAGLGH
Download sequence
Identical sequences MDP0000179336 MDP0000179336|PACid:22642763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]