SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000180803|PACid:22629519 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000180803|PACid:22629519
Domain Number 1 Region: 81-180
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.42e-27
Family 2Fe-2S ferredoxin-related 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000180803|PACid:22629519
Sequence length 194
Sequence
ASGRFLPTMLVSRLAAVRTQMINHVXKELIDMNFPGPLKSSPKTGNFGGLYSYIFHTPKH
QAFSTTTLHEEGDKKVEEISVTFVDKDEMEKHIKVPVGMSMLEAAHENDIELEGACEGSC
ACSTCHVIVRDMEYYNKLEDPTDEENDMLDLAFGLTETSRLGCQMVAKRELDGICLELPS
ATRNFAVDRHAKAT
Download sequence
Identical sequences MDP0000180803|PACid:22629519 MDP0000180803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]