SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000192434|PACid:22664172 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000192434|PACid:22664172
Domain Number 1 Region: 51-200
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 2.88e-49
Family Pollen allergen PHL P 1 N-terminal domain 0.0028
Further Details:      
 
Weak hits

Sequence:  MDP0000192434|PACid:22664172
Domain Number - Region: 188-228
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0363
Family Synaptotagmin-like (S variant) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000192434|PACid:22664172
Sequence length 379
Sequence
MTLPNLRALLGSLAVFLFVLADHLHVVAANRGRFGVHHPIKHHKPRFTAGPWKQAHATFY
EGGSGTFGGACGYHDVVQEGYGLETVALSNALFNNGLSCGACYEIKCVDEPQWCKPGNPI
LSVTATNNCPPNWNQASDNGGWCNPPREHFDIAKPVFFNIAEYKAGIIPVTYRRVPCQKK
GGMRFTITGNPYFNEVLVWNVGGAGDIISVQVKGSDKLKWTAMSRMWGQRWVTGAKMVGT
FCDRGQPRGMTSRRMRDGVFSGRPETTLRRGRREERARLSGIEEKMNNILAGVGEVNEIN
QTTEKIGSTSRVGATPNPPSPPSDVGSGGEDAREVINKRLRAKESARGIRDRAVEQATKR
LIETPPDRPDLKQHPEGSH
Download sequence
Identical sequences MDP0000192434 MDP0000192434|PACid:22664172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]