SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000220977|PACid:22675781 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000220977|PACid:22675781
Domain Number 1 Region: 303-669
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.16e-84
Family IF2B-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000220977|PACid:22675781
Sequence length 676
Sequence
MDPRRPPRTVSDPKVRQVGFFASPEPIAYSSSPPVSGISTSGNSLSPVMIPPPRHSSDTT
RPVLFAPSSARRESILAGSYNNSSEFFPASPPTASSSNGIVMGNGEFLTDVVMSPGRAFR
GVRTAAGLTTSSSFPGRGFDLTAAVKASSVPASGLMTVSVVKLPSGISEKDVDASVEVQS
ERAANSKPLKEKTTKAERRAVQEAQRAAKAASKAEGGKTPSVAASASAAANVKPPKATKL
VSQSSVAVSEKTGGGGGGGSEHLPEKERKKEVPHPRMQYDDTSRVEKAKRRSVVKQTEAR
NRVELFRHLPQYEHGTQLPDLESKFFQLDPVHPAVYKVGLQYLSGDISGGNARCIAMLLA
FQEAIKDYSTPPEKNLSRDLTAKISSYVSFFSDCRPLSITMGNAMRFLKSRIAKLPLTMS
ESEAKASLQSDIERFISEKIILADKVIVKHAVSKIRDGDVLLTYGSSSAVEMLLLHAHEL
GKQFRVVVVDSRPKLEGQRLLRRLVGKGLSCTYTHINAASCIMHEVTRVFLGASSVLSNG
TVYSRVGTACVAMVAHAFHVPVLVCCEAYKFHERVQLDSICCNELVYDNFMLRLLDSQVI
VPLLAGDPDVILKVPGRKEGNPLDGHSNCENIQPLNLIYDAXPSDYISMIITDYGMVPPT
SVPVIVREYRREHLWM
Download sequence
Identical sequences MDP0000220977 MDP0000220977|PACid:22675781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]