SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000231745|PACid:22645084 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000231745|PACid:22645084
Domain Number 1 Region: 67-173
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000000328
Family Barwin 0.033
Further Details:      
 
Weak hits

Sequence:  MDP0000231745|PACid:22645084
Domain Number - Region: 391-432
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000698
Family Barwin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000231745|PACid:22645084
Sequence length 471
Sequence
MKSFISKSSIVLLVILLSAICLVAEAQQCRPSGKIRGRKAPPGQCNXENDSDCCKPGKMY
PTYTCSPPLSGSTKATLTINSFEKGGDGGGPSECDNQYHNDNTPVVALSTGWYSNGDRCH
KQIRINGNGRSVLAMVVDECDSTEGCDADHDYQPPCPNNIVDASKAVWKALGILXFLLQE
VEKCENVMQFACSLKLNNVVQAAELXEGRPLLDINATRRXTLIAVRPXKCTQPTHVHHHC
PAEPRPTSLLTVSRKMVMEAVHQNVTTSTTMITHQLLHCRLDGTTMEEGAVTSPLVVTGA
VWWLWWWMSVTLLRXVMQIMTTKPPCPNNIVDASKAVWKALGVPKDNWGGLDITCLSCLR
ESTKHGLVYIDIQPLKCFDKSNASHTSTSKXQQTVAALPTGWSNNGGRCLHNITISGNQR
SVVAMVVDECDPTAGYLTSIMTTNHRVLTTLLTPQRLFGKHWALLRNNRVA
Download sequence
Identical sequences MDP0000231745|PACid:22645084 MDP0000231745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]