SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000246956|PACid:22652490 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000246956|PACid:22652490
Domain Number 1 Region: 50-397
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.42e-114
Family IF2B-like 0.0000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000246956|PACid:22652490
Sequence length 466
Sequence
MGPKFCSIGPVPQKKKKGEREADRKQKQHRQAQLEMAPNSEFTDGTPAPNSLQAICYKRG
SLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVRGAPAIAIAAALSLAVEIFNLEDFNG
TPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQIASEVATTTXDASKVFEAYIEASEI
MLKDDVASNKAIGSHGAXFIQHLLGNSKNISMLTHCNTGSLATAGYGTALGVIRSLHTEG
VLERAYCTETRPFNQGSRLTAFELVHDNIPGTLIADSAAAALMKFGRVNAVVVGADRVAT
NGDTANKIGTYSLAVSAKHHNIPFFVAAPLTSIDLSLSSGEEIIIEERSPKELLNTHGGL
GEQVAASGIAVWNPAFDVTPANLITGIITEKGVITKKGTDAFXIKGFVQKAAVQSAIREA
PEPQVAEFSAAQGNQGPPGAGGVTGAEQGRFGVRAESIPPWRMSCL
Download sequence
Identical sequences MDP0000246956 MDP0000246956|PACid:22652490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]