SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000252727|PACid:22647791 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000252727|PACid:22647791
Domain Number 1 Region: 420-814
Classification Level Classification E-value
Superfamily Serpins 2.49e-94
Family Serpins 0.00000812
Further Details:      
 
Domain Number 2 Region: 161-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-17
Family B3 DNA binding domain 0.006
Further Details:      
 
Domain Number 3 Region: 8-85
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000334
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000252727|PACid:22647791
Sequence length 817
Sequence
MARKGPRKKQSFFKVLLGDFSKHLRIPHAFLKNLSGLSLGKCALKGPSGKRWIVELEERE
NGLFFYAAGWQDFVKDHLLQVGDFLDVEEANGKSSNPVSLENYKGNQARVKEEIVESEAE
NYDTDCENKATIANTRSGNAMSGKRPTTGYVKETSSTCFTFKSENPCFMETLKKHQEYCL
VIPKKLAISEGLMSMGTXMLRNESGRXWCAKVILRPKSSFHRMELTTGWAXFCXANQISV
GDTVIFEFVKQSVIQIHVFRAVRGKRGVCLYDLGLFLANWFYANFIAANLEXLNYATLST
FNSETYRAPAASDNVRISIFVVPLQNVLVPLQNIFVPLQNGVVDPRLWEAIVDPSLLHSL
DPGFSIRLHIIVSNSAATAXDIVASACWRLCTSASIFYASRANALPXLLSDGSRCSSPFR
SPRWRYSSMSTKETISNVNDVSLEITKQLLTTEGKXXNMVFSPLSIQVVLWLLTAGSKGP
TREQLLAFLRSKSTDQLNSLASHLVPLIFTDGSTKGGPCLSFANGLWVKDXIPIIPSFKE
VVDTAYKAAIKHVSFVNPEEVRREVNLWAEKATKGLITEALSPGXIDHTTTLILSNALYF
KGLXSRKFDASRTITDNFHLLNGTSVXAPFMRSSGEHFVRAFDGFKVLKLPYSQGEDKER
QFSMYLLLPDEKYGLPALVERVCSEPGFLDRHXPRRRXPVGEFKIPRFKITSGFTASEIL
MDLGLVLPFNGXGDLTEMLESGXXXAKMIHKSFIEVDEDGTKAAAASVYYTLMCSAGPVE
RIEEIDFVADHPFLLLIREETTGTVMFIGHVLNPLEE
Download sequence
Identical sequences MDP0000252727 MDP0000252727|PACid:22647791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]