SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000263111|PACid:22664574 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000263111|PACid:22664574
Domain Number 1 Region: 208-409
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-37
Family Kelch motif 0.001
Further Details:      
 
Domain Number 2 Region: 131-224
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0000745
Family Galactose oxidase, central domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000263111|PACid:22664574
Sequence length 413
Sequence
MGAGRQPKIFTAPSQDLAIYSASIRNLSKNHLGESYLVEPKPQSKNAYLNNSLLIQEVEE
LKTFKIQEVEEVKAFKTEFTKQSKKIDYLEHKLEQAEAEIRCLKFCLXLESRSTPSKAHT
DEKDTESWNVLHYDPDESIYLVGGYDGESCLSAFDAYYPSEDXTKPLSPMSAVRSYASAA
QSMVLDLGHLKFISYWNEYFLXIYLWSFYEVEXYXPVTDEWKQCPSLREXKRVDCFSDVE
MLDLXAGRWIHTQSMLQKRMALAAVELKGVLYATGGYDGNSYLNFPISTVDLKYSYLSTV
DRFDPRXRSWTKIASMHSKRSCHSSVVXSEKIHVLGGFDGDSLVRSVESFDPXLGGYSAA
AVVEDTIYVIGGMKDDETIAETVEYYKEGQDWREIATMTIGRRYFMSAAASST
Download sequence
Identical sequences MDP0000263111 MDP0000263111|PACid:22664574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]