SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000267580|PACid:22676656 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000267580|PACid:22676656
Domain Number 1 Region: 236-625
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.66e-95
Family Regulator of chromosome condensation RCC1 0.001
Further Details:      
 
Domain Number 2 Region: 14-122
Classification Level Classification E-value
Superfamily PH domain-like 3.1e-25
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 624-695
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.27e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000267580|PACid:22676656
Sequence length 1139
Sequence
MADLVSYGNANRDIDQAIIALKKGAQLLKYGRKGKPKFCPFRLSTDESTLIWISSSERSL
KLASVTRIVPGQRTAVFQRYLRPEKDYLSFSLIYNNGKRSLDLICKDKVEAEVWIAGLKA
LLSSGRGGRSKIDGWSDGGLYLDDGKDLTSNSPSDSSASGARDSGSPEISVNFKPNTSPK
SFPPENSPVSERSHAASDLTNMQVKGSGSDAFRVSVSSAPSTSSHGSGPDDCEALGDVYI
WGEVICDSVVKVGADKNVNYLSPRSDVLVPRPLESNVVLDVHHIACGVKHAALVTRQGEV
FTWGEESGGRLGHGAGKDVVQPHLVESLAATSVDFAACGEFHTCAVTMAGELYTWGDGTH
NAGLLGHGTDVSHWIPKRISGPLEGLQVASVTCGPWHTALITSTGKLFTFGDGTFGVLGH
GDRENVPYPREVESLSGLRTISVACGVWHTAAVVEVIATQSSASISSGKLFTWGDGDKNR
LGHGDKEARLKPTCVPALIDYSFHKIACGHSLTVGLTTSGHVFTMGSTVYGQLGNPNSDG
KLPCLVEDKLGGDCIEEIACGAYHVAVLTSRNEVYTWGKGANGRLGHGDVEDRKTPTLVE
ALKDRHVKYICCGSEYTAAICLHKWVSGAEQSQCSACRQAFGFTRKRHNCYNCGLVHCHS
CSSKKATRAALAPNPGKPYRVCDPCYVKLNKVSETGSNNRRNAIPRLSGENKDRLDKADI
RLYKTAVPSNMDLIKQLDTKAAKQGKKADTFSLVRSAQAPSLLQLKEVVMSTAVDLRRTV
PKPVLTPSGASSRSVSPFSRRPSPPRFATPVPTTSGLSFSKSIADSLKKTNELLNQEVLK
LRSRVESLRQRCDRQELELQNSSKKVQEAMALAADESAKSKAAKEVIKSLTAQLKDLAER
LSPGVYDTETIKQALLPNGLEPNGINYPDANEEQHSRSTSISSSYLISSLGIDSATTNGN
HGPTLSPKGQLGTNETIVQHSRGPLTPNGMINSPDKLPNGGGSFETVGSSASETVDGRES
GPFRDGENGARSMNSPSPANGNTVEAEWIEQYEPGVYITLVALRDGTRDLKRVRFSRRRF
GEHQAQIWWSENREKVYEKYNVRGSDRSSVAGSAARGIERKQQKGGGYEGKHANHLFCL
Download sequence
Identical sequences MDP0000267580|PACid:22676656 MDP0000267580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]