SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000281146|PACid:22627446 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000281146|PACid:22627446
Domain Number 1 Region: 57-141
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.00000000000000291
Family 2Fe-2S ferredoxin-related 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000281146|PACid:22627446
Sequence length 157
Sequence
DMSGIGMIHISCILILFDQQSETNLLRGTIFEKHRLFSTSSASHSSNEGIEQKEKISVTF
VDKDGEEKHIKVPTGMSMLEAAHENDIELEGKDVDYYSKLEDPTDEENDMLDLAFGLTET
SRLGCQVIAKPELDGIRLAIPAATRNFAVDGYVPKPH
Download sequence
Identical sequences MDP0000281146|PACid:22627446 MDP0000281146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]