SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000283274|PACid:22663974 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000283274|PACid:22663974
Domain Number 1 Region: 378-633
Classification Level Classification E-value
Superfamily PP2C-like 3.27e-49
Family PP2C-like 0.00017
Further Details:      
 
Domain Number 2 Region: 127-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-18
Family B3 DNA binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000283274|PACid:22663974
Sequence length 769
Sequence
MVTAKSKLSYEESRQQRLEENKKRMEALNLPMLAQALNKTPNSPKPSPMKRAGKPRTYEV
QMVEVRRSTRVANRPAPDYKEVVAERVMIPRRSYXTNRHRDVANRVYASDEARAAAMVKA
DELEASLGSDHPTLVKTMLQSHVTGGFWLGLQVSFCKNHLPKGDEVMXLIDEDGDEYPTI
YLARKTGLSGGWKGFAVAHDLVDGDALVFQLIRPTTFKPAKKKXQINRXCLCXRVTCVND
GAVIVCSRIHXTKPNEPLESQAAQAFEPIIINKKGKEKNSFISFVLFHLIIRSLEREWNF
RSAPVSAFLDHSNPPPPSFPSRLALVSFARNRHCCLLIGPSLPRENHQTVPLSVLLKREL
ANEKIERPEIIHGQASQSKKGEDFTLVKTECQRIVGDGVSTYSVFGLFDGHNGSAAAIYS
KENLLTNVLAAIPSDLNRDEWVAALPRAFVAGFVKTDKEFQERSQTSGTTVTFVIIEGWV
ISVASVGDSRCIVEPAEGGVYYLSADHRLEINEEERQRITSSGGEVGRLNTGGGAEIGPL
RCWPGGLCLSRSIGDMDVGEFIVPVPYVKQIKLSTAGGRLIISSDGVWDALSAEEALDCC
RGMPPDAAAAQIVKDAVGHKGLRDDTTCIVIDILPQEKPQASLPQPKRQGKGVLFKSMFK
KKSSESSSSVEKEYIEPDEVEELFEEGSASLSERLDTKYPLCNMFKLFMCAVCQVEIKPG
EGISIHAGSSNPGKLRPWDGPFLCSSCQGKKEAMEGKRPSGRRHDSDSD
Download sequence
Identical sequences MDP0000283274|PACid:22663974 MDP0000283274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]