SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000290031|PACid:22631237 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000290031|PACid:22631237
Domain Number 1 Region: 15-362
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.65e-114
Family IF2B-like 0.0000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000290031|PACid:22631237
Sequence length 431
Sequence
MAPNSEFTDGTPAPNSLQAICYKRGSLQLLDQTKLPLQSTYLDIRDSTDGWHAIKDMVVR
GAPAIAIAAALSLAVEIFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQ
IASEVATTTXDASKVFEAYIEASEIMLKDDVASNKAIGSHGAXFIQHLLGNSKNISMLTH
CNTGSLATAGYGTALGVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPGTLIA
DSAAAALMKFGRVNAVVVGADRVATNGDTANKIGTYSLAVSAKHHNIPFFVAAPLTSIDL
SLSSGEEIIIEERSPKELLNTHGGLGEQVAASGIAVWNPAFDVTPANLITGIITEKGVIT
KKGTDAFXIKGFVQKAAVQSAIREAPEPQVAEFSAAQGNQGPPGAGGVTGAEQGRFGVRA
ESIPPWRMSCL
Download sequence
Identical sequences MDP0000290031|PACid:22631237 MDP0000290031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]