SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000292425|PACid:22635686 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000292425|PACid:22635686
Domain Number 1 Region: 483-585
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000544
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 257-396
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000416
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000292425|PACid:22635686
Sequence length 801
Sequence
MAESKPGPAQAPPDKEVKGPNLIERAKXETGAVLHTDKXHHDHKETHGLRDDIDEKTPLD
DVKAPNMFERAKEEFEAIVEAIHPKKESPTYGKMDESKKDSKKQEKADSLPENHAKTSNL
IEKAKQKIETLMHHENSPKNHDNETPEKSPKHHTKETHGRSDDIDESIPIDHVKAPNVFE
RAKEEIEAIFEAIHPKKEEKTSVSTPKKEVNMGDDHFVSNSHSNSSNISCIPVPHNRPPP
DISALARLSDNLESIVDSTDFDYFPDAKIVVNAGREVPVHRCVLSARSEFFKNVFSAKDR
GSSAAASSSSVAAPRFELKELAKEYDVGLDALLAVLGYLYSGKLRSLPKGVCVCVDDACA
HVACRPVVDFMVEVLYASATFQISELVSLYQRHLLDILEKVAIDDIXVVLYVANMCGKAC
ERLAGRCVEMXVKSDADVVTLXKALPQHSVKQIIDSRLALGLDRPQQFNSSASXSHFPDK
HTKRIHRALDSDDVELVRMLLKEGNTNLDDAXVLHYAVAYCXAKTTTELLDLGIADVNRR
NPRGYTVLHVAAMRKEPKIIVSLLTKGXXPSDLTLDGRKAVQITKRLTRAADFFKSNDEG
XSSSNDRLCIEILEQAERRDPLLGEASLSLAMAGDDLRMKLLYLENRXGLARYLFPMEXK
VVMDITQIDGDXSEFPKDLASSQRXTVDLNEAPFKIKEEHLSRLQALSRAVEIGKRFFPR
CSELLNNIMDGVDISQIQYTGNDTPELRLTKKRRYMELQEVLSQAFDKDKXEFDRSGISS
SSSSTSTGVVRSNGGTITIKK
Download sequence
Identical sequences MDP0000292425|PACid:22635686 MDP0000292425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]