SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000302286|PACid:22671565 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000302286|PACid:22671565
Domain Number 1 Region: 302-692
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.54e-97
Family Regulator of chromosome condensation RCC1 0.0006
Further Details:      
 
Domain Number 2 Region: 57-162
Classification Level Classification E-value
Superfamily PH domain-like 3.79e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 691-761
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  MDP0000302286|PACid:22671565
Domain Number - Region: 901-978
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000302286|PACid:22671565
Sequence length 1142
Sequence
MSRTDRMGSDLSRTGPVERDIEQEVLFDPKLSGLSRCLRCYIGGGDDGDDDLRVLFNAIT
ALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLNHVSRIISGQRTPIFQ
RYPRPEKEYQSFSLIYNERSLDLICKDKDEAEVWFSGLKALISRSHHRKWRTESRSDGIP
SEANSPRTYTRRSSPLNSPFGSNDSLQKDSADHLRLRSPYESPPKNGLDKALSDVILYAV
PPKGFFPSDSASASVHSVSSGGSDSVHGQMKAMAMDAVRVSLSSAVSSSSQGSGHDDGDA
LGDVFMWGEGTGDGVVGGGSHRVGSCLGAKMDSLLPKALESKVVLDVQNIACGGRHAALV
TKQGEIFSWGEESGGRLGHGVDVDVLQPKLIDALSNINIELVACGEYHTCAVTLSGDLYT
WGDGTYNFGLLGHGNEVSHWVPKRVNGPLEAMHVSSISCGPWHTAVVTSAGQLFTFGDGT
FGVLGHGDRKSVSIPREVESLKGLRTVRAACGAWHTAAVVEVMVGNSSASNCSLGKLFTW
GDGDKGRLGHGDKEAKLVPTCVAALVEXNFCRVACGHSMTVARTTSGHVYTMGSPVYGQL
GNPQADGKLPTRVEGKLSKSFVEEIACGAYHVAVLTSRTEVYTWGKGANGRLGHGNIDDR
NSPTLVEALKDKQVKSIACGANFTAVICLHKWVSGVDQSMCSGCRVPFNFKRKRHNCYNC
GLVFCHSCSSKKSLKASMAPNPSKPYRVCDNCFNKLRKAAETDTSLPTSISRRGSINQGS
NEVIDKDDKLDSRSRVQLARFSSMESLKHVETRSSKKNKKLEFNSSRVSPVPNGGSQWGA
LNISKPFNPVFGSSKKFFSASVPGSRIISRATSPISRRPSPPRSTTPTPTLGGLTSPKIV
VDDAKRTNEGLRQEVIKLRSQVESLTQKAQLQEVELERTTKQLKEAIAIAGAETAKCKAA
KEVIQSLTAQLKDMAERLPVGAVRNIKSPSLASSLGSDPSNEVPIPSTDRLNGQLTFQEP
DSNEPNSQLFSNGSNTTSNRNSGHNKQGHLDVATRNGNKIKENESHHESEWVEQDEPGVY
ITLTSLPGGAKDLKRVRFSRKRFSEKQAEQWWAENRARVYEQYNVRTVDKSSVGVGSEDL
AH
Download sequence
Identical sequences MDP0000302286|PACid:22671565 MDP0000302286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]