SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309530|PACid:22638215 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309530|PACid:22638215
Domain Number 1 Region: 552-611
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000719
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0064
Further Details:      
 
Weak hits

Sequence:  MDP0000309530|PACid:22638215
Domain Number - Region: 621-709
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0288
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000309530|PACid:22638215
Sequence length 733
Sequence
MEGGKGVGEKKGTNDVVLQISVGEEHTRYXNEIRDSNLQLTELQSLRVSGSASPEIPKPS
PSPPPGKPPKIPAEPTSRRASFSRSAFSKPKSRFVEPVPPAEKKATDEIPQLKSTANSPN
VASPSSKIAATTPRDALRSAPITPRTPLINSSEEDDDEEVYKTAKLKVREKSGKKMKKLA
VIELIAFVCIVGFXIACLTVPKLEKKMYWGLELWKWSVLVLVVLCGRLVTEWFINVLVFV
IELNFLLKKNVLYFVYGLKGSVQIFIWLSLVLLAWGLLFNRGVKRSRKTSRILGYVTRGL
ASCLIGAGIWLVKNLFVKVVASSFQCNRFFDRXQESIFHQYVLRTLSGPPLMEMAERVGK
TPSRGQLSFKNLKGGKKEGEGRAPKKRSSGLSTISDTLESLDDEESEQKGKEITSEWEAK
AVAYDIFLNVAKHSNKYIEEDDLLRFMKKEEVDNVLPLFEGAAETGKIKRKALKNWLVNV
YLERKSLAHSLNDTKTAIEELNRLASGVLLLVIIIVWLLLMGFLTTNILVFISSQLLLVV
FVFGNTAKTVFEAIIFVFVMHPFDVGDRCVVDGVQLIVEEMNILTTIFLRYDNEKIFYPN
SVLASKPISNFYRSPEMGDSVEFAVHVSTTADTIVALKARIKEYLDSKSQHWRPAHSVVV
KDIEDVNKMKMALYVTHTINFQNYGDKSSRRSDLVLELKKIFEDLGIKYKLLPQEVHLRY
VGSSTAELPPTWQ
Download sequence
Identical sequences MDP0000309530|PACid:22638215 MDP0000309530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]