SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309644|PACid:22654411 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309644|PACid:22654411
Domain Number 1 Region: 91-169
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.91e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000309644|PACid:22654411
Sequence length 171
Sequence
MAIYKSLEIFQKNPKSSVFYLLCLFQSRALIPTPTPPASLLPYVLYPSSLASTMHAKQRR
STSSAFFSAGATQFQQPLDPRVHFPNLEDAIEVFVDGYPVKIPKEFTVLQACEIAGVDIP
RFCYHRRLSIVGNCRMCLMEVEKSPKPVASCAMPAMPSMKIKTDTPIAKKA
Download sequence
Identical sequences MDP0000309644 MDP0000309644|PACid:22654411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]